PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00697.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 601aa    MW: 68446.6 Da    PI: 6.4612
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00697.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B378.56.9e-25112213199
                              EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-E CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDf 79 
                              f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g +W++k+i+r++++r++lt+GW++Fv +++L +gD+
  Rsa1.0_00697.1_g00004.1 112 FTKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYKWKFKHIFRGQPRRHLLTTGWSNFVTSKKLVAGDT 195
                              89****************************9643..445569******************************************** PP

                              EEEEE-SSSEE..EEEEE-S CS
                       B3  80 vvFkldgrsefelvvkvfrk 99 
                              +vF   + +++el+v+v+r+
  Rsa1.0_00697.1_g00004.1 196 FVFL--RGENGELRVGVRRA 213
                              ****..449999******97 PP

2Auxin_resp114.21.2e-37238317183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              a ha++t+s+F+v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe++ds+err+sGtvvgv+d++p +W++SkWrsL+
  Rsa1.0_00697.1_g00004.1 238 ACHATQTRSMFTVYYKPRT--SQFIISLNKYLEAMNNKFSVGMRFKMRFEGDDSPERRFSGTVVGVQDCSP-HWKDSKWRSLQ 317
                              6899**************6..9*************************************************.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.84E-39101241IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.4E-43103227IPR015300DNA-binding pseudobarrel domain
CDDcd100171.38E-21110212No hitNo description
SMARTSM010192.5E-25112214IPR003340B3 DNA binding domain
PROSITE profilePS5086313.014112214IPR003340B3 DNA binding domain
PfamPF023628.6E-23112213IPR003340B3 DNA binding domain
PfamPF065077.0E-34238317IPR010525Auxin response factor
PfamPF023092.7E-7468525IPR033389AUX/IAA domain
SuperFamilySSF542777.19E-12484565No hitNo description
PROSITE profilePS5174524.81489589IPR000270PB1 domain
PfamPF023091.4E-5532577IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MTIGDDMYEE LWKLSAGPLV DVPQAEERVY YFPQGHMEQL EASTQQDLNT MKPLFDLPPK  60
ILCRVMNVRL QAEKDTDEVY AQIMLMPEET LDEPTSPDPS LPESQRPKFH SFTKVLTASD  120
TSTHGGFSVL RKHATECLPP LDMTQQTPTQ ELVAEDVHGY KWKFKHIFRG QPRRHLLTTG  180
WSNFVTSKKL VAGDTFVFLR GENGELRVGV RRANRQQSSM PSSVISSHSM HLGVLATACH  240
ATQTRSMFTV YYKPRTSQFI ISLNKYLEAM NNKFSVGMRF KMRFEGDDSP ERRFSGTVVG  300
VQDCSPHWKD SKWRSLQVNW DEPASFTRPV KVSPWEMEPF VTSENVPQSV NKRPRHVNEV  360
SARLGVTTSN LWSSALTQSC ITSQRNPPQY SDWPVSPYST LNGQMVFQVD QKKHETTGCR  420
LFGIDLMSPS LPASEEKTAL MRPINVNKPD LDSNTDPKSE ISKLSEEKKQ EPAQASPKEV  480
QSKQISSSRS RTKVQMQGVP VGRAVDLTLL NGYVELIDDL EKLFDIEGEL KSRNQWEIVF  540
TDDEGDMMLL GDDPWPEFCN MVKRIFIWSK EEVKKMTPGN QLRILLTEVD TTVSKTENYS  600
N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-166234014355Auxin response factor 1
4ldw_A1e-166234014355Auxin response factor 1
4ldw_B1e-166234014355Auxin response factor 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794730.0JN979473.1 Brassica rapa subsp. pekinensis auxin response factor 9-1 (ARF9-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619833.10.0PREDICTED: auxin response factor 9 isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A078IBW50.0A0A078IBW5_BRANA; Auxin response factor
TrEMBLA0A0D3A5S70.0A0A0D3A5S7_BRAOL; Auxin response factor
STRINGBra013748.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9